| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PHKA2 |
|---|
| Clone | 3H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunohistochemistry-Paraffin. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHKA2 Antibody (3H3) from Novus Biologicals is a mouse monoclonal antibody to PHKA2. This antibody reacts with human. The PHKA2 Antibody (3H3) has been validated for the following applications: ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PHKA2 (NP_000283 428 a.a. - 521 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT |
|---|
| Other Names | GSD9A, MGC133071, PHK, PHKLA, phosphorylase b kinase regulatory subunit alpha liver isoform, phosphorylase b kinase regulatory subunit alpha, liver isoform, Phosphorylase kinase alpha L subunit, phosphorylase kinase alpha-subunit, phosphorylase kinase, alpha 2 (liver), PYK, PYKL, XLG, XLG2 |
|---|
| Gene, Accession # | PHKA2, Gene ID: 5256, Accession: NP_000283, SwissProt: NP_000283 |
|---|
| Catalog # | H00005256-M04 |
|---|
| Price | |
|---|
| Order / More Info | PHKA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|