| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRPS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRPS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRPS1. This antibody reacts with human. The PRPS1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Specificity of human PRPS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP |
|---|
| Other Names | CMTX5ARTS, deafness, X-linked 2, perceptive, congenital, DFN2, DFNX1KIAA0967, dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1), EC 2.7.6.1, Phosphoribosyl pyrophosphate synthase I, phosphoribosyl pyrophosphate synthetase 1, PPRibP, PRSI, PRS-I, ribose-phosphate diphosphokinase 1, ribose-phosphate pyrophosphokinase 1 |
|---|
| Gene, Accession # | PRPS1, Gene ID: 5631 |
|---|
| Catalog # | NBP2-13813 |
|---|
| Price | |
|---|
| Order / More Info | PRPS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|