| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZC3H8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZC3H8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZC3H8. This antibody reacts with human. The ZC3H8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZC3H8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NLKAGHKNGKQKKMKRKWPGPGNKGSNALLRNSGSQEEDGKPKEKQQHLSQAFINQHT |
| Other Names | Fliz1, ZC3HDC8, zinc finger CCCH domain-containing protein 8, zinc finger CCCH type domain containing 8, zinc finger CCCH-type containing 8, zinc finger CCCH-type domain containing 8 |
| Gene, Accession # | ZC3H8, Gene ID: 84524, Accession: Q8N5P1, SwissProt: Q8N5P1 |
| Catalog # | NBP2-33980 |
| Price | |
| Order / More Info | ZC3H8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|