| Edit |   |
| Antigenic Specificity | ZC3H3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZC3H3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZC3H3. This antibody reacts with mouse. The ZC3H3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Zc3h3. Immunizing peptide sequence KEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGAR. |
| Other Names | KIAA0150zinc finger CCCH-type domain containing 3, ZC3HDC3, zinc finger CCCH domain-containing protein 3, zinc finger CCCH type domain containing 3, zinc finger CCCH-type containing 3 |
| Gene, Accession # | ZC3H3, Gene ID: 23144, Accession: Q8CHP0 |
| Catalog # | NBP1-74066 |
| Price | |
| Order / More Info | ZC3H3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |