| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZCCHC17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZCCHC17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZCCHC17. This antibody reacts with human. The ZCCHC17 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK |
|---|
| Other Names | HSPC251, nucleolar protein of 40 kDa, Pnn-interacting nucleolar protein, pNO40nucleolar protein 40, PS1D protein, PS1DRP11-266K22.1, putative S1 RNA binding domain protein, Putative S1 RNA-binding domain protein, Zinc finger CCHC domain-containing protein 17, zinc finger, CCHC domain containing 17 |
|---|
| Gene, Accession # | ZCCHC17, Gene ID: 51538 |
|---|
| Catalog # | NBP2-68707 |
|---|
| Price | |
|---|
| Order / More Info | ZCCHC17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|