| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZBTB7A/Pokemon |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZBTB7A/Pokemon Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZBTB7A/Pokemon. This antibody reacts with human. The ZBTB7A/Pokemon Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZBTB7A/Pokemon antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN |
| Other Names | DKFZp547O146, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, FBI-1POK erythroid myeloid ontogenic factor, FBI1TTF-I-interacting peptide 21, HIV-1 inducer of short transcripts binding protein, Leukemia/lymphoma-related factor, LRFHIV-1 1st-binding protein 1, lymphoma related factor, MGC99631, pokemon, TIP21, ZBTB7zinc finger and BTB domain containing 7, zinc finger and BTB domain containing 7A, zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein, zinc finger and BTB domain-containing protein 7A, Zinc finger protein 857A, ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor |
| Gene, Accession # | ZBTB7A, Gene ID: 51341, Accession: O95365, SwissProt: O95365 |
| Catalog # | NBP2-38550 |
| Price | |
| Order / More Info | ZBTB7A/Pokemon Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|