| Edit |   |
|---|
| Antigenic Specificity | TTYH3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTYH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTYH3. This antibody reacts with human. The TTYH3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human TTYH3. Peptide sequence IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA. |
|---|
| Other Names | hTTY3, KIAA1691, protein tweety homolog 3, tweety homolog 3 (Drosophila) |
|---|
| Gene, Accession # | TTYH3, Gene ID: 80727, Accession: NP_079526, SwissProt: NP_079526 |
|---|
| Catalog # | NBP1-91350-20ul |
|---|
| Price | |
|---|
| Order / More Info | TTYH3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|