| Edit |   |
|---|
| Antigenic Specificity | TTYH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTYH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTYH1. This antibody reacts with human. The TTYH1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TTYH1(tweety homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of TTYH1. Peptide sequence GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA. |
|---|
| Other Names | hTTY1, protein tweety homolog 1, tweety (Drosophila) homolog 1, tweety homolog 1 (Drosophila) |
|---|
| Gene, Accession # | TTYH1, Gene ID: 57348, Accession: Q9H313, SwissProt: Q9H313 |
|---|
| Catalog # | NBP1-59909 |
|---|
| Price | |
|---|
| Order / More Info | TTYH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|