| Edit |   |
|---|
| Antigenic Specificity | ARVCF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARVCF Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARVCF. This antibody reacts with human. The ARVCF Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ARVCF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DDTRSLAADDEGGPELEPDYGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAP |
|---|
| Other Names | armadillo repeat gene deleted in velocardiofacial syndrome, armadillo repeat protein deleted in velo-cardio-facial syndrome, FLJ35345 |
|---|
| Gene, Accession # | ARVCF, Gene ID: 421, Accession: O00192, SwissProt: O00192 |
|---|
| Catalog # | NBP2-38999 |
|---|
| Price | |
|---|
| Order / More Info | ARVCF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|