| Edit |   |
| Antigenic Specificity | ARV1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARV1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARV1. This antibody reacts with human. The ARV1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ARV1(ARV1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ARV1 (NP_073623). Peptide sequence: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD. |
| Other Names | ARV1 homolog (S. cerevisiae), ARV1 homolog (yeast), hARV1, protein ARV1 |
| Gene, Accession # | ARV1, Gene ID: 64801, Accession: Q9H2C2, SwissProt: Q9H2C2 |
| Catalog # | NBP1-59542 |
| Price | |
| Order / More Info | ARV1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |