| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Artemis |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Artemis Antibody from Novus Biologicals is a rabbit polyclonal antibody to Artemis. This antibody reacts with human. The Artemis Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Artemis antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS |
|---|
| Other Names | ASCID, DCLREC1C, DNA cross-link repair 1C, DNA cross-link repair 1C protein, EC 3.1, FLJ36438, hSNM1C, protein artemis, Protein A-SCID, PSO2 homolog, RS-SCID, severe combined immunodeficiency, type a (Athabascan), SNM1 homolog C, SNM1CS. cerevisiae), SNM1-like protein |
|---|
| Gene, Accession # | DCLRE1C, Gene ID: 64421 |
|---|
| Catalog # | NBP2-56362 |
|---|
| Price | |
|---|
| Order / More Info | Artemis Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|