| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOP2A |
|---|
| Clone | 1E2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOP2A Antibody (1E2) from Novus Biologicals is a mouse monoclonal antibody to TOP2A. This antibody reacts with human. The TOP2A Antibody (1E2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | TOP2A (NP_001058 1435 a.a. - 1531 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF |
|---|
| Other Names | DNA topoisomerase (ATP-hydrolyzing), DNA topoisomerase 2-alpha, DNA topoisomerase II, 170 kD, DNA topoisomerase II, alpha isozyme, EC 5.99.1.3, TOP2DNA gyrase, topoisomerase (DNA) II alpha (170kD), topoisomerase (DNA) II alpha 170kDa, TP2A |
|---|
| Gene, Accession # | TOP2A, Gene ID: 7153, Accession: NP_001058, SwissProt: NP_001058 |
|---|
| Catalog # | H00007153-M01 |
|---|
| Price | |
|---|
| Order / More Info | TOP2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26132639 |
|---|
| 产品资料 |
|
|