| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tomosyn |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tomosyn Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tomosyn. This antibody reacts with human. The Tomosyn Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Tomosyn antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDN |
|---|
| Other Names | FLJ30922, Lethal(2) giant larvae protein homolog 3, LGL3, LLGL3Nbla04300, MGC141942, MGC141968, putative protein product of Nbla04300, syntaxin binding protein 5 (tomosyn), syntaxin-binding protein 5, tomosyn, tomosyn-1 |
|---|
| Gene, Accession # | STXBP5, Gene ID: 134957 |
|---|
| Catalog # | NBP2-56176 |
|---|
| Price | |
|---|
| Order / More Info | Tomosyn Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|