| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOMM40L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOMM40L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOMM40L. This antibody reacts with human. The TOMM40L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TOMM40L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGD M |
|---|
| Other Names | FLJ12770, mitochondrial import receptor subunit TOM40B, Protein TOMM40-like, TOMM40BRP11-297K8.10, translocase of outer mitochondrial membrane 40 homolog (yeast)-like, translocase of outer mitochondrial membrane 40 homolog-like, translocase of outer mitochondrial membrane 40 homolog-like (yeast) |
|---|
| Gene, Accession # | TOMM40L, Gene ID: 84134 |
|---|
| Catalog # | NBP2-13463 |
|---|
| Price | |
|---|
| Order / More Info | TOMM40L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|