| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOMM40 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOMM40 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOMM40. This antibody reacts with human. The TOMM40 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TOMM40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM |
|---|
| Other Names | C19orf1mitochondrial import receptor subunit TOM40 homolog, D19S1177E, mitochondrial outer membrane protein, PER-EC1, PEREC1Translocase of outer membrane 40 kDa subunit homolog, Protein Haymaker, TOM40p38.5, translocase of outer mitochondrial membrane 40 homolog (yeast) |
|---|
| Gene, Accession # | TOMM40, Gene ID: 10452, Accession: O96008, SwissProt: O96008 |
|---|
| Catalog # | NBP2-38289 |
|---|
| Price | |
|---|
| Order / More Info | TOMM40 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|