| Edit |   |
| Antigenic Specificity | SLC16A12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC16A12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC16A12. This antibody reacts with human. The SLC16A12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYS |
| Other Names | CJMG, DKFZp686E188, MCT 12, MCT12monocarboxylate transporter 12, solute carrier family 16 (monocarboxylic acid transporters), member 12, Solute carrier family 16 member 12, solute carrier family 16, member 12 (monocarboxylic acid transporter 12) |
| Gene, Accession # | SLC16A12, Gene ID: 387700 |
| Catalog # | NBP1-82789 |
| Price | |
| Order / More Info | SLC16A12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |