| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC14A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC14A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC14A1. This antibody reacts with human. The SLC14A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC14A1(solute carrier family 14 (urea transporter), member 1 (Kidd blood group)) The peptide sequence was selected from the C terminal of SLC14A1. Peptide sequence LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGF |
|---|
| Other Names | FLJ33745, HsT1341, HUT11, JKFLJ41687, RACH1, solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Solute carrier family 14 member 1, truncated urea transporter, urea transporter 1, urea transporter JK glycoprotein, Urea transporter, erythrocyte, urea transporter-B1, UT1UT-B1, UTEblood group Kidd urea transporter |
|---|
| Gene, Accession # | SLC14A1, Gene ID: 6563, Accession: Q13336, SwissProt: Q13336 |
|---|
| Catalog # | NBP1-60115 |
|---|
| Price | |
|---|
| Order / More Info | SLC14A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|