| Edit |   |
|---|
| Antigenic Specificity | SLC10A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC10A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC10A3. This antibody reacts with human. The SLC10A3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human SLC10A3The immunogen for this antibody is SLC10A3. Peptide sequence MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV. |
|---|
| Other Names | solute carrier family 10 (sodium/bile acid cotransporter family), member 3 |
|---|
| Gene, Accession # | SLC10A3, Gene ID: 8273, Accession: NP_062822, SwissProt: NP_062822 |
|---|
| Catalog # | NBP1-79316 |
|---|
| Price | |
|---|
| Order / More Info | SLC10A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|