| Edit |   |
| Antigenic Specificity | SLC10A3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC10A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC10A3. This antibody reacts with human. The SLC10A3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human SLC10A3The immunogen for this antibody is SLC10A3. Peptide sequence MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV. |
| Other Names | solute carrier family 10 (sodium/bile acid cotransporter family), member 3 |
| Gene, Accession # | SLC10A3, Gene ID: 8273, Accession: NP_062822, SwissProt: NP_062822 |
| Catalog # | NBP1-79316-20ul |
| Price | |
| Order / More Info | SLC10A3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |