| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUDT12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT12. This antibody reacts with human. The NUDT12 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NUDT12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEI EDARWFTREQVLDVLTKGKQQAFFVPPSRAIA |
|---|
| Other Names | DKFZp761I172, EC 3.6.1.22, nucleoside diphosphate linked moiety X-type motif 12, Nucleoside diphosphate-linked moiety X motif 12, nudix (nucleoside diphosphate linked moiety X)-type motif 12, Nudix motif 12, peroxisomal NADH pyrophosphatase NUDT12 |
|---|
| Gene, Accession # | NUDT12, Gene ID: 83594 |
|---|
| Catalog # | NBP2-13681 |
|---|
| Price | |
|---|
| Order / More Info | NUDT12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|