| 产品详情 |
| Edit |   |
| Antigenic Specificity | NUDC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NUDC Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDC. This antibody reacts with human, mouse, rat. The NUDC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NUDC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT |
| Other Names | HNUDC, MNUDC, NPD011, nuclear distribution gene C (A.nidulans) homolog, nuclear distribution gene C homolog (A. nidulans), Nuclear distribution protein C homolog, nuclear migration protein nudC, NudC |
| Gene, Accession # | NUDC, Gene ID: 10726 |
| Catalog # | NBP1-89517 |
| Price | |
| Order / More Info | NUDC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|