| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC25A33 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC25A33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC25A33. This antibody reacts with human, mouse, rat. The SLC25A33 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SLC25A33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEK |
|---|
| Other Names | BMSC-MCPPNC1 protein, Bone marrow stromal cell mitochondrial carrier protein, HuBMSC-MCP, MGC4399, mitochondrial carrier protein, novel mitochondrial carrier protein, Protein PNC1, solute carrier family 25 member 33, solute carrier family 25, member 33 |
|---|
| Gene, Accession # | SLC25A33, Gene ID: 84275 |
|---|
| Catalog # | NBP2-13323 |
|---|
| Price | |
|---|
| Order / More Info | SLC25A33 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|