| Edit |   |
|---|
| Antigenic Specificity | SLC25A32 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC25A32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC25A32. This antibody reacts with human. The SLC25A32 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the middle region of SLC25A32 (NP_110407). Peptide sequence NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID. |
|---|
| Other Names | MFTCMFTFLJ23872, mitochondrial folate transporter/carrier, Solute carrier family 25 member 32, solute carrier family 25, member 32 |
|---|
| Gene, Accession # | SLC25A32, Gene ID: 81034, Accession: Q9H2D1, SwissProt: Q9H2D1 |
|---|
| Catalog # | NBP1-59566 |
|---|
| Price | |
|---|
| Order / More Info | SLC25A32 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 10978331 |
|---|