| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC25A24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC25A24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC25A24. This antibody reacts with human. The SLC25A24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the N terminal of SLC25A24. Peptide sequence MDSLYGDLFWYLDYNKDGTLDIFELQEGLE |
| Other Names | APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24 |
| Gene, Accession # | SLC25A24, Gene ID: 29957, Accession: Q6NUK1-2, SwissProt: Q6NUK1-2 |
| Catalog # | NBP1-59557-20ul |
| Price | |
| Order / More Info | SLC25A24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|