| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GDI1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GDI1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GDI1. This antibody reacts with human. The GDI1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GDI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK |
|---|
| Other Names | FLJ41411, GDI-1, GDIL, GDP dissociation inhibitor 1, Guanosine diphosphate dissociation inhibitor 1, mental retardation, X-linked 41, mental retardation, X-linked 48, MRX41, oligophrenin-2, OPHN2MRX48, Protein XAP-4, Rab GDI alpha, rab GDP dissociation inhibitor alpha, rab GDP-dissociation inhibitor, alpha, RABGDIARABGD1A, XAP4, XAP-4 |
|---|
| Gene, Accession # | GDI1, Gene ID: 2664 |
|---|
| Catalog # | NBP2-49264 |
|---|
| Price | |
|---|
| Order / More Info | GDI1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|