| 产品详情 |
| Edit |   |
| Antigenic Specificity | FARS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FARS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FARS2. This antibody reacts with human. The FARS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to FARS2(phenylalanyl-tRNA synthetase 2, mitochondrial) The peptide sequence was selected from the N terminal of FARS2. Peptide sequence VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ. |
| Other Names | dJ236A3.1, dJ520B18.2, dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase)), EC 6.1.1, EC 6.1.1.20, FARS1dJ236A3.1 (phenylalanine-tRNA synthetase), HSPC320, phenylalanine translase, phenylalanine tRNA ligase 2, mitochondrial, Phenylalanine--tRNA ligase, phenylalanine-tRNA synthetase 1 (mitochondrial), phenylalanine-tRNA synthetase 2 (mitochondrial), phenylalanyl-tRNA synthetase 2, mitochondrial, phenylalanyl-tRNA synthetase, mitochondrial, PheRS |
| Gene, Accession # | FARS2, Gene ID: 10667, Accession: O95363, SwissProt: O95363 |
| Catalog # | NBP1-57378 |
| Price | |
| Order / More Info | FARS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|