| Edit |   |
| Antigenic Specificity | FANK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FANK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FANK1. This antibody reacts with mouse. The FANK1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Fank1 (fibronectin type 3 and ankyrin repeat domains 1) The peptide sequence was selected from the middle region of Fank1. Peptide sequence LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN. |
| Other Names | 1700007B22Rik, fibronectin type 3 and ankyrin repeat domains 1, fibronectin type 3 and ankyrin repeat domains protein 1, fibronectin type III and ankyrin repeat domains 1 |
| Gene, Accession # | FANK1, Gene ID: 92565, Accession: Q9DAM9 |
| Catalog # | NBP1-69009 |
| Price | |
| Order / More Info | FANK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |