| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RhoGAP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RhoGAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to RhoGAP. This antibody reacts with human. The RhoGAP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RhoGAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDE |
|---|
| Other Names | growth factor independent 2, p100 RasGAP-associated p105 protein, p105 RhoGAP, p190-BGFI2, p190BRhoGAP, Rho GTPase activating protein 5, rho GTPase-activating protein 5, RHOGAP5, Rho-type GTPase-activating protein 5 |
|---|
| Gene, Accession # | ARHGAP5, Gene ID: 394 |
|---|
| Catalog # | NBP2-58620 |
|---|
| Price | |
|---|
| Order / More Info | RhoGAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|