| Edit |   |
|---|
| Antigenic Specificity | MGC50722 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MGC50722 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGC50722. This antibody reacts with human. The MGC50722 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human MGC50722. Peptide sequence DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC. |
|---|
| Other Names | hypothetical MGC50722, hypothetical protein LOC399693 |
|---|
| Gene, Accession # | MGC50722, Gene ID: 399693, Accession: NP_976223, SwissProt: NP_976223 |
|---|
| Catalog # | NBP1-91472 |
|---|
| Price | |
|---|
| Order / More Info | MGC50722 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|