| Edit |   |
| Antigenic Specificity | MGC16471 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MGC16471 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGC16471. This antibody reacts with human. The MGC16471 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C3orf31. Peptide sequence LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS. |
| Other Names | chromosome 3 open reading frame 31, DKFZp434E0519, MGC16471, mitochondrial |
| Gene, Accession # | TAMM41, Gene ID: 132001, Accession: NP_620162, SwissProt: NP_620162 |
| Catalog # | NBP1-79270 |
| Price | |
| Order / More Info | MGC16471 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |