| 产品详情 |
| Edit |   |
| Antigenic Specificity | cGAS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. ICC/IF reactivity reported in scientific literature (PMID: 24970844]). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The cGAS Antibody from Novus Biologicals is a rabbit polyclonal antibody to cGAS. This antibody reacts with human. The cGAS Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF |
| Other Names | C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1 |
| Gene, Accession # | MB21D1, Gene ID: 115004 |
| Catalog # | NBP1-86761-25ul |
| Price | |
| Order / More Info | cGAS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24284630, 24404168, 24970844 |
| 产品资料 |
|
|