| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Breast carcinoma amplified sequence 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Breast carcinoma amplified sequence 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Breast carcinoma amplified sequence 3. This antibody reacts with human. The Breast carcinoma amplified sequence 3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Breast carcinoma amplified sequence 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ |
|---|
| Other Names | BCAS4/BCAS3 fusion, breast carcinoma amplified sequence 3, breast carcinoma amplified sequence 4/3 fusion protein, breast carcinoma-amplified sequence 3, DKFZp686O1527, FLJ20128, GAOB1, MAAB, metastasis associated antigen of breast cancer, MGC4973, protein Maab1 |
|---|
| Gene, Accession # | BCAS3, Gene ID: 54828 |
|---|
| Catalog # | NBP2-58584 |
|---|
| Price | |
|---|
| Order / More Info | Breast carcinoma amplified sequence 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|