| Edit |   |
| Antigenic Specificity | MFAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MFAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MFAP1. This antibody reacts with human. The MFAP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MFAP1(microfibrillar-associated protein 1) The peptide sequence was selected from the middle region of MFAP1. Peptide sequence TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT. |
| Other Names | microfibrillar-associated protein 1 |
| Gene, Accession # | MFAP1, Gene ID: 4236, Accession: P55081, SwissProt: P55081 |
| Catalog # | NBP1-56849 |
| Price | |
| Order / More Info | MFAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |