| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MEX3D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEX3D Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEX3D. This antibody reacts with human. The MEX3D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MEX3D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DVFAGFAPHPAALGPPTLLADQMSVICGRKK |
|---|
| Other Names | KIAA2031Tino, mex-3 homolog D (C. elegans), OK/SW-cl.4, ring finger (C3HC4 type) and KH domain containing 1, ring finger and KH domain containing 1, RING finger and KH domain-containing protein 1, RING finger protein 193, RKHD1MEX3, RNA-binding protein MEX3D, RNF193MEX-3D, TINObcl-2 ARE RNA binding protein |
|---|
| Gene, Accession # | MEX3D, Gene ID: 399664, Accession: Q86XN8, SwissProt: Q86XN8 |
|---|
| Catalog # | NBP2-39056 |
|---|
| Price | |
|---|
| Order / More Info | MEX3D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|