| Edit |   |
| Antigenic Specificity | METTL11B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The METTL11B Antibody from Novus Biologicals is a rabbit polyclonal antibody to METTL11B. This antibody reacts with human. The METTL11B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C1ORF184 The peptide sequence was selected from the C terminal of C1ORF184. Peptide sequence NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV. |
| Other Names | C1orf184, methyltransferase like 11B, methyltransferase-like protein 11B, NTM1B, X-Pro-Lys N-terminal protein methyltransferase 1B |
| Gene, Accession # | METTL11B, Gene ID: 149281 |
| Catalog # | NBP1-70635 |
| Price | |
| Order / More Info | METTL11B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |