| Edit |   |
|---|
| Antigenic Specificity | METTL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The METTL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to METTL4. This antibody reacts with rat. The METTL4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human Mettl4The immunogen for this antibody is Mettl4. Peptide sequence SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS. |
|---|
| Other Names | EC 2.1.1.-, FLJ23017, HsT661, methyltransferase like 4, methyltransferase-like protein 4, MGC117235 |
|---|
| Gene, Accession # | METTL4, Gene ID: 64863, Accession: NP_001178743 |
|---|
| Catalog # | NBP1-79301-20ul |
|---|
| Price | |
|---|
| Order / More Info | METTL4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|