| Edit |   |
|---|
| Antigenic Specificity | Layilin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Layilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Layilin. This antibody reacts with human. The Layilin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LAYN(layilin) The peptide sequence was selected from the N terminal of LAYN. Peptide sequence CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL. |
|---|
| Other Names | FLJ30977, FLJ31092, layilin |
|---|
| Gene, Accession # | LAYN, Gene ID: 143903, Accession: Q6UX15-2, SwissProt: Q6UX15-2 |
|---|
| Catalog # | NBP1-69660 |
|---|
| Price | |
|---|
| Order / More Info | Layilin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|