| Edit |   |
| Antigenic Specificity | Layilin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Layilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Layilin. This antibody reacts with human. The Layilin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LAYN(layilin) The peptide sequence was selected form the N terminal of LAYN. Peptide sequence CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL. |
| Other Names | FLJ30977, FLJ31092, layilin |
| Gene, Accession # | LAYN, Gene ID: 143903, Accession: Q6UX15-2, SwissProt: Q6UX15-2 |
| Catalog # | NBP1-62663-20ul |
| Price | |
| Order / More Info | Layilin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |