| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APPD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APPD Antibody from Novus Biologicals is a rabbit polyclonal antibody to APPD. This antibody reacts with human. The APPD Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human APPDThe immunogen for this antibody is APPD. Peptide sequence QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS. |
|---|
| Other Names | Apoptosis-inducing protein, APPDapoptosis-inducing protein D, LAPF, Lysosome-associated apoptosis-inducing protein containing PH and FYVE domains, MGC4090, PH and FYVE domain-containing protein 1, PH domain-containing family F member 1, phafin-1, PHAFIN1, pleckstrin homology domain containing, family F (with FYVE domain) member 1, pleckstrin homology domain-containing family F member 1, ZFYVE15phafin 1, Zinc finger FYVE domain-containing protein 15 |
|---|
| Gene, Accession # | PLEKHF1, Gene ID: 79156, Accession: NP_077286, SwissProt: NP_077286 |
|---|
| Catalog # | NBP1-79945-20ul |
|---|
| Price | |
|---|
| Order / More Info | APPD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|