| Edit |   |
| Antigenic Specificity | APPBP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The APPBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to APPBP2. This antibody reacts with human. The APPBP2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Amyloid precursor protein (cytoplasmic tail) binding protein 2). The peptide sequence was selected from the middle region of Amyloid precursor protein (NP_006371). Peptide sequence: QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLL |
| Other Names | amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1 |
| Gene, Accession # | APPBP2, Gene ID: 10513, Accession: Q92624, SwissProt: Q92624 |
| Catalog # | NBP1-53085-20ul |
| Price | |
| Order / More Info | APPBP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |