| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLEKHA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLEKHA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLEKHA3. This antibody reacts with human. The PLEKHA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PLEKHA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS |
|---|
| Other Names | FAPP-1, FAPP1PH domain-containing family A member 3, FLJ20067, four-phosphate-adaptor protein 1, Phosphatidylinositol-four-phosphate adapter protein 1, Phosphoinositol 4-phosphate adapter protein 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 3, pleckstrin homology domain-containing family A member 3, pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 3 |
|---|
| Gene, Accession # | PLEKHA3, Gene ID: 65977, Accession: Q9HB20, SwissProt: Q9HB20 |
|---|
| Catalog # | NBP2-32018 |
|---|
| Price | |
|---|
| Order / More Info | PLEKHA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|