| Edit |   |
| Antigenic Specificity | RSPH10B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RSPH10B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RSPH10B. This antibody reacts with human. The RSPH10B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RSPH10B(radial spoke head 10 homolog B (Chlamydomonas)) The peptide sequence was selected from the middle region of RSPH10B. Peptide sequence EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN. |
| Other Names | MGC50833, radial spoke head 10 homolog B, radial spoke head 10 homolog B (Chlamydomonas), radial spoke head 10 homolog B2, RSPH10B2 |
| Gene, Accession # | RSPH10B, Gene ID: 222967, Accession: B2RC85, SwissProt: B2RC85 |
| Catalog # | NBP1-56466 |
| Price | |
| Order / More Info | RSPH10B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |