| 产品详情 |
| Edit |   |
| Antigenic Specificity | TUSC4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TUSC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TUSC4. This antibody reacts with human. The TUSC4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TUSC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSP GTTVRDLIGRHPQQLQHVD |
| Other Names | G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4 |
| Gene, Accession # | NPRL2, Gene ID: 10641, Accession: Q8WTW4, SwissProt: Q8WTW4 |
| Catalog # | NBP1-82537 |
| Price | |
| Order / More Info | TUSC4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|