| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tumstatin/COL4A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26331477). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tumstatin/COL4A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tumstatin/COL4A3. This antibody reacts with human, mouse. The Tumstatin/COL4A3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Tumstatin/COL4A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG |
|---|
| Other Names | collagen alpha-3(IV) chain, collagen IV, alpha-3 polypeptide, collagen, type IV, alpha 3 (Goodpasture antigen), Goodpasture antigen, tumstatin |
|---|
| Gene, Accession # | COL4A3, Gene ID: 1285 |
|---|
| Catalog # | NBP1-85836 |
|---|
| Price | |
|---|
| Order / More Info | Tumstatin/COL4A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26331477 |
|---|
| 产品资料 |
|
|