| Edit |   |
|---|
| Antigenic Specificity | G gamma7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G gamma7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to G gamma7. This antibody reacts with human. The G gamma7 Antibody has been validated for the following applications: Western Blot, Proximity Ligation Assay. |
|---|
| Immunogen | GNG7 (NP_443079.1, 1 a.a. - 68 a.a.) full-length human protein. MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
|---|
| Other Names | FLJ00058, GNGT7, guanine nucleotide binding protein (G protein), gamma 7, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 |
|---|
| Gene, Accession # | GNG7, Gene ID: 2788, Accession: NP_443079.1, SwissProt: NP_443079.1 |
|---|
| Catalog # | H00002788-D01P |
|---|
| Price | |
|---|
| Order / More Info | G gamma7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|