| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | G gamma14 |
|---|
| Clone | 1G11-C7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G gamma14 Antibody (1G11-C7) from Novus Biologicals is a mouse monoclonal antibody to G gamma14. This antibody reacts with human. The G gamma14 Antibody (1G11-C7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GNGT2 (AAH08663, 1 a.a. - 69 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS |
|---|
| Other Names | G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 |
|---|
| Gene, Accession # | GNGT2, Gene ID: 2793, Accession: AAH08663, SwissProt: AAH08663 |
|---|
| Catalog # | H00002793-M01 |
|---|
| Price | |
|---|
| Order / More Info | G gamma14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|