| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | G gamma14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G gamma14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to G gamma14. This antibody reacts with human. The G gamma14 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: gamma-T2 |
|---|
| Immunogen | Synthetic peptides corresponding to GNGT2 The peptide sequence was selected from the middle region of GNGT2. Peptide sequence KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS. |
|---|
| Other Names | G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 |
|---|
| Gene, Accession # | GNGT2, Gene ID: 2793, Accession: O14610, SwissProt: O14610 |
|---|
| Catalog # | NBP1-56676 |
|---|
| Price | |
|---|
| Order / More Info | G gamma14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|