| Edit |   |
|---|
| Antigenic Specificity | DMRTC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DMRTC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DMRTC2. This antibody reacts with human. The DMRTC2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human DMRTC2. Peptide sequence VLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQ. |
|---|
| Other Names | DMRT-like family C2, doublesex- and mab-3-related transcription factor C2 |
|---|
| Gene, Accession # | DMRTC2, Gene ID: 63946, Accession: NP_001035373, SwissProt: NP_001035373 |
|---|
| Catalog # | NBP1-80128-20ul |
|---|
| Price | |
|---|
| Order / More Info | DMRTC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|