| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSG-6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSG-6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSG-6. This antibody reacts with human. The TSG-6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSG-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQ |
|---|
| Other Names | Hyaluronate-binding protein, TNF alpha-induced protein 6, TNF-stimulated gene 6 protein, TSG-6tumor necrosis factor alpha-inducible protein 6, TSG6tumor necrosis factor-inducible gene 6 protein, Tumor necrosis factor alpha-induced protein 6, tumor necrosis factor, alpha-induced protein 6, tumor necrosis factor-stimulated gene-6 protein |
|---|
| Gene, Accession # | TNFAIP6, Gene ID: 7130, Accession: P98066, SwissProt: P98066 |
|---|
| Catalog # | NBP2-38637 |
|---|
| Price | |
|---|
| Order / More Info | TSG-6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27739342 |
|---|
| 产品资料 |
|
|