| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SOX10 |
|---|
| Clone | 1E6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SOX10 Antibody (1E6) from Novus Biologicals is a mouse monoclonal antibody to SOX10. This antibody reacts with human, mouse. The SOX10 Antibody (1E6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | SOX10 (NP_008872 336 a.a. - 433 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR |
|---|
| Other Names | MGC15649, PCWH, SRY (sex determining region Y)-box 10, SRY-related HMG-box gene 10, transcription factor SOX-10, WS4C, WS4mouse, human homolog of |
|---|
| Gene, Accession # | SOX10, Gene ID: 6663, Accession: NP_008872, SwissProt: NP_008872 |
|---|
| Catalog # | H00006663-M01 |
|---|
| Price | |
|---|
| Order / More Info | SOX10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23397944, 26024302 |
|---|
| 产品资料 |
|
|